PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.23997s0022.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HB-other
Protein Properties Length: 354aa    MW: 38956.1 Da    PI: 4.5057
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.23997s0022.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.7e-08291338653
                           S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
              Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                           + +k  +e+Le+++++++ p+ +    + + ++L+ ++V  WF  +Ra
  Bostr.23997s0022.1.p 291 RVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEEKRA 338
                           567899*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.378283343IPR001356Homeobox domain
SuperFamilySSF466897.27E-8288348IPR009057Homeodomain-like
SMARTSM003897.3E-4289347IPR001356Homeobox domain
PfamPF000465.7E-6291338IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-8291350IPR009057Homeodomain-like
CDDcd000862.36E-5294338No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAVALSSSSG VVSHLYPPLF SSSSGLSVNR VLFRNGHAST FSVAIPFHSP SRSVLVFARG  60
KNRNGFASSP SSSSPKRNKK KSFEGDDNGG GEEEDDPFEA LFNLLEEDLK NDKSSIDDEE  120
ISEEELDALA DELARALGGG DDDDGIDLFG SATGDVVDDG DDGDDEDEDE DDDDDSEEDE  180
RPTKLKNWQL RRLAYALKAG RRKTSIKNLA AEVCLDRAYV LELLRDPPPK LLMLSATLPD  240
EKPPVAAPEN SSPDPNPVES SLAEDIVVEP EKKIKDEAVH VMQQRWSAQK RVKKAHIETL  300
EKVYRRSKRP TNAVVSSIVQ VTNLPRKRVL KWFEEKRAED GVPEKRAPYQ APV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0020170.0BT002017.1 Arabidopsis thaliana putative protein (At5g11270) mRNA, complete cds.
GenBankBT0087430.0BT008743.1 Arabidopsis thaliana At5g11270 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289083.11e-177hypothetical protein CARUB_v10002492mg
SwissprotQ8H0V51e-161OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLR0FIW41e-176R0FIW4_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__1093__AT5G11270.11e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-114overexpressor of cationic peroxidase 3